PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00121520001
Common NameGSBRNA2T00121520001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 326aa    MW: 37031.8 Da    PI: 7.3686
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00121520001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-31191245256
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          +r+rW++eLH++Fv+a+++LGGs++AtPk+i+++mkv+gLt+++vkSHLQkYR++
  GSBRNA2T00121520001 191 QRRRWSQELHRKFVDALHSLGGSQVATPKQIRDMMKVDGLTNDEVKSHLQKYRMH 245
                          8****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-27187248IPR009057Homeodomain-like
PROSITE profilePS5129412.256187247IPR017930Myb domain
SuperFamilySSF466893.18E-17188248IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-24191245IPR006447Myb domain, plants
PfamPF002499.7E-8192243IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MVQTDSDKMG LNLNLSMYSL AKPLSQFLDE VSRIKDYDSK LSEIDGYVGK LEEERRKIDV  60
FKRELPLCML LLNEAIETLK EEASSSVMMA SDGKLDVGEG AKVESDNKKN WMSSAQLWIS  120
NPNSQLQSTN EKEDRSVTHR PNQRGAFTPF NLPPPPPPPL TLRTPPSEIL MDYNHQFNKP  180
MQSLHSQKKE QRRRWSQELH RKFVDALHSL GGSQVATPKQ IRDMMKVDGL TNDEVKSHLQ  240
KYRMHIRKHP LHPAKTLSSS DQPVLLDKET QSLISLTRSD SPQSPLVDGC LFNNNGHSSE  300
DEEKSDGRSW KSESNKKRQA LDLEL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.93251e-144seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00121520001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ9738390.0DQ973839.1 Brassica napus clone PBCESTNA15 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013733371.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A078CFJ20.0A0A078CFJ2_BRANA; BnaA01g00920D protein
STRINGBra011720.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49222652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-150G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]